ATG2B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8498
Article Name: ATG2B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8498
Supplier Catalog Number: A8498
Alternative Catalog Number: ABB-A8498-100UL,ABB-A8498-20UL,ABB-A8498-1000UL,ABB-A8498-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BLTP4B, C14orf103, ATG2B
This gene encodes a protein required for autophagy. The encoded protein is involved in autophagosome formation. A germline duplication of a region that includes this gene is associated with predisposition to myeloid malignancies.
Clonality: Polyclonal
Molecular Weight: 233kDa
NCBI: 55102
UniProt: Q96BY7
Purity: Affinity purification
Sequence: IQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGK
Target: ATG2B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of various lysates using ATG2B Rabbit pAb (A8498) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.