RMI2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8523
Article Name: RMI2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8523
Supplier Catalog Number: A8523
Alternative Catalog Number: ABB-A8523-20UL,ABB-A8523-100UL,ABB-A8523-1000UL,ABB-A8523-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BLAP18, C16orf75, RMI2
RMI2 is a component of the BLM (RECQL3, MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 116028
UniProt: Q96E14
Purity: Affinity purification
Sequence: MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Target: RMI2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag
Western blot analysis of various lysates using RMI2 Rabbit pAb (A8523) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.