NOX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8527
Article Name: NOX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8527
Supplier Catalog Number: A8527
Alternative Catalog Number: ABB-A8527-20UL,ABB-A8527-100UL,ABB-A8527-500UL,ABB-A8527-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MOX1, NOH1, NOH-1, GP91-2, NOH-1L, NOX1
This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 27035
UniProt: Q9Y5S8
Purity: Affinity purification
Sequence: RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
Target: NOX1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Nucleotide metabolism,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using NOX1 Rabbit pAb (A8527) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.