CALCRL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8533
Article Name: CALCRL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8533
Supplier Catalog Number: A8533
Alternative Catalog Number: ABB-A8533-20UL,ABB-A8533-100UL,ABB-A8533-1000UL,ABB-A8533-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CRLR, CGRPR, LMPHM8, CALCRL
Enables adrenomedullin binding activity, adrenomedullin receptor activity, and calcitonin gene-related peptide receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway, cellular response to sucrose stimulus, and receptor internalization. Located in endoplasmic reticulum, endosome, and lysosome. Part of CGRP receptor complex and adrenomedullin receptor complex. Colocalizes with plasma membrane. Implicated in hereditary lymphedema.
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 10203
UniProt: Q16602
Purity: Affinity purification
Sequence: GIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Target: CALCRL
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using CALCRL Rabbit pAb (A8533) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.