TPPP/p25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8574
Article Name: TPPP/p25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8574
Supplier Catalog Number: A8574
Alternative Catalog Number: ABB-A8574-100UL,ABB-A8574-20UL,ABB-A8574-1000UL,ABB-A8574-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p24, p25, TPPP1, TPPP/p25, p25alpha
Enables several functions, including GTPase activity, magnesium ion binding activity, and protein homodimerization activity. Involved in several processes, including microtubule cytoskeleton organization, negative regulation of tubulin deacetylation, and positive regulation of protein polymerization. Located in several cellular components, including mitochondrion, mitotic spindle, and perinuclear region of cytoplasm. Colocalizes with microtubule and microtubule bundle.
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 11076
UniProt: O94811
Purity: Affinity purification
Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Target: TPPP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of various lysates using TPPP/p25 Rabbit pAb (A8574) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.