ATG2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8576
Article Name: ATG2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8576
Supplier Catalog Number: A8576
Alternative Catalog Number: ABB-A8576-100UL,ABB-A8576-20UL,ABB-A8576-1000UL,ABB-A8576-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BLTP4A, ATG2A
Predicted to enable phosphatidylinositol-3-phosphate binding activity. Involved in autophagosome assembly. Predicted to be located in endoplasmic reticulum membrane, lipid droplet, and phagophore assembly site membrane. Predicted to be active in phagophore assembly site. Predicted to be extrinsic component of membrane.
Clonality: Polyclonal
Molecular Weight: 213kDa
NCBI: 23130
UniProt: Q2TAZ0
Purity: Affinity purification
Sequence: DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT
Target: ATG2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ATG2A Rabbit pAb (A8576) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.