CRNN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8762
Article Name: CRNN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8762
Supplier Catalog Number: A8762
Alternative Catalog Number: ABB-A8762-20UL,ABB-A8762-100UL,ABB-A8762-500UL,ABB-A8762-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DRC1, PDRC1, SEP53, C1orf10, CRNN
This gene encodes a member of the fused gene family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 49860
UniProt: Q9UBG3
Purity: Affinity purification
Sequence: GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP
Target: CRNN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using CRNN Rabbit pAb (A8762) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.