NAGK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9070
Article Name: NAGK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9070
Supplier Catalog Number: A9070
Alternative Catalog Number: ABB-A9070-20UL,ABB-A9070-100UL,ABB-A9070-500UL,ABB-A9070-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GNK, HSA242910, NAGK
This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 55577
UniProt: Q9UJ70
Purity: Affinity purification
Sequence: IYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV
Target: NAGK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using NAGK Rabbit pAb (A9070) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.