FKBP1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9074
Article Name: FKBP1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9074
Supplier Catalog Number: A9074
Alternative Catalog Number: ABB-A9074-100UL,ABB-A9074-20UL,ABB-A9074-500UL,ABB-A9074-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OTK4, FKBP1L, PKBP1L, PPIase, FKBP12.6, FKBP1B
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 2281
UniProt: P68106
Purity: Affinity purification
Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Target: FKBP1B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using FKBP1B Rabbit pAb (A9074) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.