SQRDL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9256
Article Name: SQRDL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9256
Supplier Catalog Number: A9256
Alternative Catalog Number: ABB-A9256-100UL,ABB-A9256-20UL,ABB-A9256-1000UL,ABB-A9256-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SQR, SQRDL, CGI-44, PRO1975
The protein encoded by this gene may function in mitochondria to catalyze the conversion of sulfide to persulfides, thereby decreasing toxic concencrations of sulfide. Alternative splicing results in multiple transcript variants that encode the same protein.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 58472
UniProt: Q9Y6N5
Purity: Affinity purification
Sequence: LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
Target: SQOR
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using SQRDL Rabbit pAb (A9256) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.