VAV2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9483
Article Name: VAV2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9483
Supplier Catalog Number: A9483
Alternative Catalog Number: ABB-A9483-100UL,ABB-A9483-20UL,ABB-A9483-1000UL,ABB-A9483-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: VAV-2, VAV2
VAV2 is the second member of the VAV guanine nucleotide exchange factor family of oncogenes. Unlike VAV1, which is expressed exclusively in hematopoietic cells, VAV2 transcripts were found in most tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 101kDa
NCBI: 7410
UniProt: P52735
Purity: Affinity purification
Sequence: PPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRER
Target: VAV2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cytoskeleton,Actins,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using VAV2 Rabbit pAb (A9483) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.