SYCP3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9548
Article Name: SYCP3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9548
Supplier Catalog Number: A9548
Alternative Catalog Number: ABB-A9548-20UL,ABB-A9548-100UL,ABB-A9548-500UL,ABB-A9548-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COR1, SCP3, SPGF4, RPRGL4, SYCP3
This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 50511
UniProt: Q8IZU3
Purity: Affinity purification
Sequence: MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Target: SYCP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using SYCP3 Rabbit pAb (A9548) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.