UACA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9713
Article Name: UACA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9713
Supplier Catalog Number: A9713
Alternative Catalog Number: ABB-A9713-100UL,ABB-A9713-20UL,ABB-A9713-1000UL,ABB-A9713-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NUCLING, UACA
This gene encodes a protein that contains ankyrin repeats and coiled coil domains and likely plays a role in apoptosis. Studies in rodents have implicated the encoded protein in the stimulation of apoptosis and the regulation of mammary gland involution, in which the mammary gland returns to its pre-pregnant state. This protein has also been proposed to negatively regulate apoptosis based on experiments in human cell lines in which the protein was shown to interact with PRKC apoptosis WT1 regulator protein, also known as PAR-4, and inhibit translocation of the PAR-4 receptor. Autoantibodies to this protein have been identified in human patients with panuveitis and Graves disease. Differential expression of this gene has been observed in various human cancers.
Clonality: Polyclonal
Molecular Weight: 163kDa
NCBI: 55075
UniProt: Q9BZF9
Purity: Affinity purification
Sequence: MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIH
Target: UACA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using UACA Rabbit pAb (A9713) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.