GNG3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9817
Article Name: GNG3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9817
Supplier Catalog Number: A9817
Alternative Catalog Number: ABB-A9817-100UL,ABB-A9817-20UL,ABB-A9817-500UL,ABB-A9817-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HG3D, GNG3
Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The gamma subunit determines the specificity of which signaling pathways will be affected by this particular complex. The protein encoded by this gene represents the gamma subunit of both inhibitory and stimulatory complexes.
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 2785
UniProt: P63215
Purity: Affinity purification
Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Target: GNG3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,Small G proteins,mTOR Signaling Pathway,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates using GNG3 Rabbit pAb (A9817) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.