KCNJ3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9824
Article Name: KCNJ3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9824
Supplier Catalog Number: A9824
Alternative Catalog Number: ABB-A9824-20UL,ABB-A9824-100UL,ABB-A9824-1000UL,ABB-A9824-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KGA, GIRK1, KIR3.1, KCNJ3
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and plays an important role in regulating heartbeat. It associates with three other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex that also couples to neurotransmitter receptors in the brain and whereby channel activation can inhibit action potential firing by hyperpolarizing the plasma membrane. These multimeric G-protein-gated inwardly-rectifying potassium (GIRK) channels may play a role in the pathophysiology of epilepsy, addiction, Downs syndrome, ataxia, and Parkinsons disease. Alternative splicing results in multiple transcript variants encoding distinct proteins.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 3760
UniProt: P48549
Purity: Affinity purification
Sequence: NGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRY
Target: KCNJ3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Cardiovascular,Heart,Cardiac arrhythmias. Shipping: Ice Bag
Western blot analysis of various lysates using KCNJ3 Rabbit pAb (A9824) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.