POLE4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9882
Article Name: POLE4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9882
Supplier Catalog Number: A9882
Alternative Catalog Number: ABB-A9882-20UL,ABB-A9882-100UL,ABB-A9882-1000UL,ABB-A9882-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: p12, YHHQ1, POLE4
POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 56655
UniProt: Q9NR33
Purity: Affinity purification
Sequence: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Target: POLE4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of various lysates using POLE4 Rabbit pAb (A9882) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.