CLEC7A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9883
Article Name: CLEC7A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9883
Supplier Catalog Number: A9883
Alternative Catalog Number: ABB-A9883-100UL,ABB-A9883-20UL,ABB-A9883-500UL,ABB-A9883-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BGR, CD369, CANDF4, SCARE2, DECTIN1, CLECSF12, CLEC7A
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Clonality: Polyclonal
Molecular Weight: 28 kDa
NCBI: 64581
UniProt: Q9BXN2
Purity: Affinity purification
Sequence: SWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
Target: CLEC7A
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using CLEC7A Rabbit pAb (A9883) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.