STRA13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9892
Article Name: STRA13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9892
Supplier Catalog Number: A9892
Alternative Catalog Number: ABB-A9892-100UL,ABB-A9892-20UL,ABB-A9892-500UL,ABB-A9892-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: D9, MHF2, CENP-X, FAAP10, STRA13
Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.
Clonality: Polyclonal
Molecular Weight: 9kDa
NCBI: 201254
UniProt: A8MT69
Purity: Affinity purification
Sequence: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
Target: CENPX
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag
Western blot analysis of lysates from H460 cells, using STRA13 Rabbit pAb (A9892) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.