FABP12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9894
Article Name: FABP12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9894
Supplier Catalog Number: A9894
Alternative Catalog Number: ABB-A9894-20UL,ABB-A9894-100UL,ABB-A9894-500UL,ABB-A9894-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FABP12
Predicted to enable lipid binding activity. Predicted to be located in cytosol.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 646486
UniProt: A6NFH5
Purity: Affinity purification
Sequence: MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS
Target: FABP12
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using FABP12 Rabbit pAb (A9894) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.