ITGAE Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9934
Article Name: ITGAE Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9934
Supplier Catalog Number: A9934
Alternative Catalog Number: ABB-A9934-100UL,ABB-A9934-20UL,ABB-A9934-1000UL,ABB-A9934-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD103, HUMINAE, ITGAE
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
Clonality: Polyclonal
Molecular Weight: 130kDa
NCBI: 3682
UniProt: P38570
Purity: Affinity purification
Sequence: FNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAG
Target: ITGAE
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of various lysates using ITGAE Rabbit pAb (A9934) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.