MT-CO3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9939
Article Name: MT-CO3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9939
Supplier Catalog Number: A9939
Alternative Catalog Number: ABB-A9939-100UL,ABB-A9939-20UL,ABB-A9939-500UL,ABB-A9939-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COX3, MT-CO3
Predicted to enable electron transfer activity and oxidoreduction-driven active transmembrane transporter activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and respiratory chain complex IV assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system, brain, heart, integumental system, and sensory organ. Human ortholog(s) of this gene implicated in MELAS syndrome. Orthologous to human MT-CO3 (mitochondrially encoded cytochrome c oxidase III).
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 17710
Purity: Affinity purification
Sequence: MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWA
Target: mt-Co3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology & Developmental Biology,Endocrine & Metabolism,Mitochondrial metabolism,Cytochromes,Mitochondrial markers,Oxidative phosphorylation,Lipid Metabolism,Cytochromes,Lipases,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using MT-CO3 Rabbit pAb (A9939) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.