MT-ND4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9941
Article Name: MT-ND4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9941
Supplier Catalog Number: A9941
Alternative Catalog Number: ABB-A9941-20UL,ABB-A9941-100UL,ABB-A9941-1000UL,ABB-A9941-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ND4, MT-ND4
Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport, mitochondrial electron transport, NADH to ubiquinone, and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy, Parkinsons disease, macular degeneration, and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 17719
Purity: Affinity purification
Sequence: LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
Target: mt-Nd4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine & Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of various lysates using MT-ND4 Rabbit pAb (A9941) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.