PEA15 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9956
Article Name: PEA15 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9956
Supplier Catalog Number: A9956
Alternative Catalog Number: ABB-A9956-100UL,ABB-A9956-20UL,ABB-A9956-500UL,ABB-A9956-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PED, MAT1, HMAT1, MAT1H, PEA-15, HUMMAT1H, PED-PEA15, PED/PEA15, PEA15
This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 8682
UniProt: Q15121
Purity: Affinity purification
Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Target: PEA15
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Protein phosphorylation,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using PEA15 Rabbit pAb (A9956) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.