DET1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9974
Article Name: DET1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9974
Supplier Catalog Number: A9974
Alternative Catalog Number: ABB-A9974-100UL,ABB-A9974-20UL,ABB-A9974-1000UL,ABB-A9974-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DET1
Enables ubiquitin ligase-substrate adaptor activity and ubiquitin protein ligase binding activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process, protein ubiquitination, and protein-containing complex assembly. Part of Cul4A-RING E3 ubiquitin ligase complex.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 55070
UniProt: Q7L5Y6
Purity: Affinity purification
Sequence: HVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNIL
Target: DET1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using DET1 Rabbit pAb (A9974) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.