CHRNA9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9975
Article Name: CHRNA9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9975
Supplier Catalog Number: A9975
Alternative Catalog Number: ABB-A9975-20UL,ABB-A9975-100UL,ABB-A9975-1000UL,ABB-A9975-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NACHRA9, HSA243342, CHRNA9
This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 55584
UniProt: Q9UGM1
Purity: Affinity purification
Sequence: ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
Target: CHRNA9
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using CHRNA9 Rabbit pAb (A9975) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.