AGK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9976
Article Name: AGK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9976
Supplier Catalog Number: A9976
Alternative Catalog Number: ABB-A9976-100UL,ABB-A9976-20UL,ABB-A9976-500UL,ABB-A9976-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MULK, CATC5, CTRCT38, MTDPS10, AGK
The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 55750
UniProt: Q53H12
Purity: Affinity purification
Sequence: KAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSPTQ
Target: AGK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from SK-MEL-28 cells, using AGK Rabbit pAb (A9976) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.