AGK Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A9976
- Images (1)
| Article Name: | AGK Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A9976 |
| Supplier Catalog Number: | A9976 |
| Alternative Catalog Number: | ABB-A9976-100UL,ABB-A9976-20UL,ABB-A9976-500UL,ABB-A9976-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MULK, CATC5, CTRCT38, MTDPS10, AGK |
| The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10. |
| Clonality: | Polyclonal |
| Molecular Weight: | 47kDa |
| NCBI: | 55750 |
| UniProt: | Q53H12 |
| Purity: | Affinity purification |
| Sequence: | KAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSPTQ |
| Target: | AGK |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from SK-MEL-28 cells, using AGK Rabbit pAb (A9976) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
