UBE2Q2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A9992
Article Name: UBE2Q2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A9992
Supplier Catalog Number: A9992
Alternative Catalog Number: ABB-A9992-100UL,ABB-A9992-20UL,ABB-A9992-500UL,ABB-A9992-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UBE2Q2
Enables ubiquitin-protein transferase activity. Involved in protein K48-linked ubiquitination. Predicted to be located in cytosol. Predicted to be active in nucleus.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 92912
UniProt: Q8WVN8
Purity: Affinity purification
Sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED
Target: UBE2Q2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using UBE2Q2 Rabbit pAb (A9992) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.