beta-Actin Rabbit mAb, Unconjugated
Catalog Number:
ABB-AC038
- Images (8)
| Article Name: | beta-Actin Rabbit mAb, Unconjugated |
| Biozol Catalog Number: | ABB-AC038 |
| Supplier Catalog Number: | AC038 |
| Alternative Catalog Number: | ABB-AC038-100UL,ABB-AC038-200UL,ABB-AC038-50UL,ABB-AC038-1000UL,ABB-AC038-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | BRWS1, PS1TP5BP1, beta-Actin |
| This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome. |
| Clonality: | Monoclonal |
| Clone Designation: | [ARC5115-01] |
| Molecular Weight: | 42 kDa |
| NCBI: | 60 |
| UniProt: | P60709 |
| Purity: | Affinity purification |
| Sequence: | MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF |
| Target: | ACTB |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:10000 - 1:100000|IHC-P,1:400 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat,Chicken,Zebrafish,Pig. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells using beta-Actin Rabbit mAb (AC038) at 1:10000-1:160000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using beta-Actin Rabbit mAb (AC038) at 1:50000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat spleen_ tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat spleen_ tissue using beta-Actin Rabbit mAb (AC038) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
Product Guarantee and Expert Support
