Mouse anti mCherry-Tag mAb, IgG1, Unconjugated

Catalog Number: ABB-AE002
Article Name: Mouse anti mCherry-Tag mAb, IgG1, Unconjugated
Biozol Catalog Number: ABB-AE002
Supplier Catalog Number: AE002
Alternative Catalog Number: ABB-AE002-500UL,ABB-AE002-50UL,ABB-AE002-1000UL,ABB-AE002-200UL,ABB-AE002-100UL
Manufacturer: ABclonal
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: mCherry,mCherry tag,mCherry-tag
Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes.Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.
Clonality: Monoclonal
Clone Designation: [AMC0502]
Isotype: IgG1
Purity: Affinity purification
Sequence: MLSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Target: mCherry
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:25000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Species independent. Shipping: Ice Bag
Western blot analysis of extracts of normal 293T cells and 293T transfected with CT55 Protein, using Mouse anti mCherry-Tag mAb (AE002) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.