HRP-conjugated Mouse anti GST-Tag mAb

Catalog Number: ABB-AE027
Article Name: HRP-conjugated Mouse anti GST-Tag mAb
Biozol Catalog Number: ABB-AE027
Supplier Catalog Number: AE027
Alternative Catalog Number: ABB-AE027-1000UL,ABB-AE027-50UL,ABB-AE027-200UL,ABB-AE027-100UL,ABB-AE027-500UL
Manufacturer: ABclonal
Host: Mouse
Category: Antikörper
Application: WB
Species Reactivity: All
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: HRP
Alternative Names: GST,GST tag,GST-tag
Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal-also known as MAPEG-proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.
Clonality: Monoclonal
Concentration: WB
Clone Designation: [AMC0513]
Molecular Weight: 26kDa
UniProt: P08515
Purity: Affinity purification
Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Target: GST
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:20000
Application Notes: Cross-Reactivity: Species independent. Shipping: Ice Bag
Western blot analysis of recombinant GST Protein using HRP-conjugated Mouse anti GST-Tag mAb (AE027) at 1:5000 dilution.
Lysates/proteins: 20 ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.