Recombinant Mouse PDGF-AA Protein

Catalog Number: ABB-RP03145
Article Name: Recombinant Mouse PDGF-AA Protein
Biozol Catalog Number: ABB-RP03145
Supplier Catalog Number: RP03145
Alternative Catalog Number: ABB-RP03145-50UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Ser87-Arg196
Alternative Names: PDGF1, PDGF-A, PDGFA
Recombinant Mouse PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Arg196) of Mouse PDGF-AA (Accession NP_032834.1) fused with a 6*His tag at the N-terminus.
Concentration: Please contact us for more information.
Molecular Weight: 14.5 kDa.
Tag: N-His
NCBI: 18590
UniProt: P20033
Source: Pichia
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
Target: PDGF-AA
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Cytokines & Cytokine receptors. Shipping: Ice Bag
Recombinant Mouse PDGF-AA Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.