Recombinant Human ABHD4 Protein

Catalog Number: ABB-RP03195
Article Name: Recombinant Human ABHD4 Protein
Biozol Catalog Number: ABB-RP03195
Supplier Catalog Number: RP03195
Alternative Catalog Number: ABB-RP03195-20UG,ABB-RP03195-100UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Asp342
Alternative Names: ABHD4,(Lyso)-N-acylphosphatidylethanolamine lipase, 3.1.1.-, Alpha/beta hydrolase domain-containing protein 4, Abhydrolase domain-containing protein 4, Alpha/beta-hydrolase 4
Recombinant Human ABHD4 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Asp342) of Human ABHD4 (Accession NP_071343.2) fused with a His tag at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 40 kDa.
Tag: N-His
NCBI: 63874
UniProt: Q8TB40
Source: Baculovirus-Insect Cells
Purity: 80% as determined by SDS-PAGE.
Form: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0.
Sequence: MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETA
Target: ABHD4
Application Dilute: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human ABHD4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.