Recombinant Human NDRG1 Protein

Catalog Number: ABB-RP03256
Article Name: Recombinant Human NDRG1 Protein
Biozol Catalog Number: ABB-RP03256
Supplier Catalog Number: RP03256
Alternative Catalog Number: ABB-RP03256-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Cys394
Alternative Names: NDRG1, CAP43, DRG1, RTP, TARG1, CMT4D, GC4, HMSNL, NDR1, NMSL, PROXY1, RIT42, TDD5, N-myc downstream-regulated gene 1 protein, Differentiation-related gene 1 protein, Reducing agents and tunicamycin-responsive protein
Recombinant Human NDRG1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys394) of human NDRG1 (Accession Q92597) fused with His tag at the C-terminus.
Concentration: Please contact us for more information.
Molecular Weight: 43.8 kDa
Tag: C-His
NCBI: 10397
UniProt: Q92597
Source: E.coli
Purity: 85 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPA
Target: NDRG1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human NDRG1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.