Recombinant Human Calumenin/CALU Protein

Catalog Number: ABB-RP03261
Article Name: Recombinant Human Calumenin/CALU Protein
Biozol Catalog Number: ABB-RP03261
Supplier Catalog Number: RP03261
Alternative Catalog Number: ABB-RP03261-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala413
Alternative Names: Calreticulin, CRP55, ERp60, HACBP, grp60, CALR, CRTC, cC1qR, HEL-S-99n, SSA
Recombinant Human Calumenin/CALU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala413) of Human Calumenin/CALU (Accession P27797) fused with His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 47.4 kDa
Tag: C-His
NCBI: 811
UniProt: P27797
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE, 90 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDE
Target: CALR
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Calumenin/CALU Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.