Anti-PRC1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10047-100
Article Name: Anti-PRC1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10047-100
Supplier Catalog Number: A10047-100
Alternative Catalog Number: ABC-A10047-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 351-620 of human PRC1 (NP_003972.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PRC1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 72 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASK
Target: PRC1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200