A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.
Alternative Names:
Protein Wnt-7a, WNT7A
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas €'' Rothschild / Schinzel phocomelia syndromes.
