Anti-VEGF Receptor 1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10088
| Article Name: |
Anti-VEGF Receptor 1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10088 |
| Supplier Catalog Number: |
ABO10088 |
| Alternative Catalog Number: |
ABT-ABO10088-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human VEGF Receptor 1 (DPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE). |
| Alternative Names: |
Vascular endothelial growth factor receptor 1, VEGFR-1, 2.7.10.1, Fms-like tyrosine kinase 1, FLT-1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, FLT, Vascular permeability factor receptor, FLT1, FLT, FRT, VEGFR1 |
| Rabbit IgG polyclonal antibody for VEGF Receptor 1 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
150769 |
| NCBI: |
2321 |
| UniProt: |
P17948 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
