Anti-Ogg1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10110
| Article Name: |
Anti-Ogg1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10110 |
| Supplier Catalog Number: |
ABO10110 |
| Alternative Catalog Number: |
ABT-ABO10110-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human Ogg1 (KYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQD). |
| Alternative Names: |
N-glycosylase/DNA lyase, 8-oxoguanine DNA glycosylase, 3.2.2.-, DNA-(apurinic or apyrimidinic site) lyase, AP lyase, 4.2.99.18, OGG1, MMH, MUTM, OGH1 |
| Rabbit IgG polyclonal antibody for Ogg1 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
38782 |
| NCBI: |
4968 |
| UniProt: |
O15527 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
