Anti-KCNH1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10137
| Article Name: |
Anti-KCNH1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10137 |
| Supplier Catalog Number: |
ABO10137 |
| Alternative Catalog Number: |
ABT-ABO10137-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA). |
| Alternative Names: |
Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1, EAG channel 1, h-eag, hEAG1, Voltage-gated potassium channel subunit Kv10.1, KCNH1 |
| Rabbit IgG polyclonal antibody for KCNH1 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
111423 |
| NCBI: |
3756 |
| UniProt: |
O95259 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
