Anti-MST1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10147
| Article Name: |
Anti-MST1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10147 |
| Supplier Catalog Number: |
ABO10147 |
| Alternative Catalog Number: |
ABT-ABO10147-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE). |
| Alternative Names: |
Hepatocyte growth factor-like protein, Macrophage stimulatory protein, Macrophage-stimulating protein, MSP, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain, MST1, D3F15S2, DNF15S2, HGFL |
| Rabbit IgG polyclonal antibody for MST1 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
80320 |
| NCBI: |
4485 |
| UniProt: |
P26927 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
