Anti-ANGPTL3 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10269
| Article Name: |
Anti-ANGPTL3 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10269 |
| Supplier Catalog Number: |
ABO10269 |
| Alternative Catalog Number: |
ABT-ABO10269-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human ANGPTL3 (RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN). |
| Alternative Names: |
Angiopoietin-related protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like protein 3, ANGPTL3(17-221), ANGPTL3(17-224), ANGPTL3, ANGPT5 |
| Rabbit IgG polyclonal antibody for ANGPTL3 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
53637 |
| NCBI: |
27329 |
| UniProt: |
Q9Y5C1 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
