Anti-GSK3 alpha Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10279
| Article Name: |
Anti-GSK3 alpha Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10279 |
| Supplier Catalog Number: |
ABO10279 |
| Alternative Catalog Number: |
ABT-ABO10279-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR). |
| Alternative Names: |
Glycogen synthase kinase-3 alpha, GSK-3 alpha, 2.7.11.26, Serine/threonine-protein kinase GSK3A, 2.7.11.1, GSK3A |
| Rabbit IgG polyclonal antibody for GSK3 alpha detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
50981 |
| NCBI: |
2931 |
| UniProt: |
P49840 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
