CDKN2C Antibody
Catalog Number:
ASB-ARP30196_P050
- Images (3)
| Article Name: | CDKN2C Antibody |
| Biozol Catalog Number: | ASB-ARP30196_P050 |
| Supplier Catalog Number: | ARP30196_P050 |
| Alternative Catalog Number: | ASB-ARP30196_P050-25UL,ASB-ARP30196_P050-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Proteine/Peptide |
| Application: | IHC |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ |
| Alternative Names: | p18, INK4C, p18-INK4C |
| The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. |
|
|
Rabbit Anti-CDKN2C antibody Catalog Number: ARP30196 Formalin Fixed Paraffin Embedded Tissue: Human Skeletal Muscle Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-CDKN2C antibody Catalog Number: ARP30196 Formalin Fixed Paraffin Embedded Tissue: Human Thymus Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
CDKN2C Antibody (ARP30196_P050) in Human Skeletal Muscle using Immunohistochemistry |
Product Guarantee and Expert Support
