PCTP Antibody
Catalog Number:
ASB-ARP64249_P050
- Images (4)
| Article Name: | PCTP Antibody |
| Biozol Catalog Number: | ASB-ARP64249_P050 |
| Supplier Catalog Number: | ARP64249_P050 |
| Alternative Catalog Number: | ASB-ARP64249_P050-25UL,ASB-ARP64249_P050-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Proteine/Peptide |
| Application: | IHC |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP |
| Alternative Names: | PC-TP, STARD2 |
|
|
Rabbit Anti-PCTP antibody Catalog Number: ARP64249 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-PCTP antibody Catalog Number: ARP64249 Formalin Fixed Paraffin Embedded Tissue: Human Testis Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Host: Rabbit Target Name: PCTP1 Sample Type: Lane 1: 40 ug Human Liver lysate Lane 2: 40 ug Mouse Liver lysate Lane 3: 40 ug Rat Liver lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit secondary antibody conjugated with Alexa Fluor 647 Secondary Antibody Dilution: 1:2500 Submitted by: Hua Jiang, University of Colorado. |
|
|
PCTP antibody - middle region (ARP64249_P050) in Human, Mouse, Rat lysate using Western Blot |
Product Guarantee and Expert Support
