Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active)

Catalog Number: BYT-ORB1096687
Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active)
Biozol Catalog Number: BYT-ORB1096687
Supplier Catalog Number: orb1096687
Alternative Catalog Number: BYT-ORB1096687-1,BYT-ORB1096687-100,BYT-ORB1096687-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K),partial (Active) spans the amino acid sequence from region 319-541aa(E484K). Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 54.4 kDa
UniProt: P0DTC2
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 µg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 µg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 µg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 µg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml.