DT3C Protein

Catalog Number: BYT-ORB1477852
Article Name: DT3C Protein
Biozol Catalog Number: BYT-ORB1477852
Supplier Catalog Number: orb1477852
Alternative Catalog Number: BYT-ORB1477852-1,BYT-ORB1477852-100,BYT-ORB1477852-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This DT3C Protein spans the amino acid sequence from region 33-417aa(P00588)+linker(GGGGSGGGGSGGGGS)+291-497aa(P19909). Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 69.4 kDa
UniProt: P19909
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Corynephage beta
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTAL
Application Notes: Biological Origin: Corynephage beta. Biological Activity: After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CHOK1/Human CCR8 cells. The ED50 is 0.3708-0.5608 µg/ml. ②After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CT26/Human CCR8 cells. The ED50 is 0.4661-0.8614 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CHOK1/Human CCR8 cells. The ED50 is 0.3708-0.5608 µg/ml.
After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CT26/Human CCR8 cells. The ED50 is 0.4661-0.8614 µg/ml.