DT3C Protein
Catalog Number:
BYT-ORB1477852
- Images (3)
| Article Name: | DT3C Protein |
| Biozol Catalog Number: | BYT-ORB1477852 |
| Supplier Catalog Number: | orb1477852 |
| Alternative Catalog Number: | BYT-ORB1477852-1,BYT-ORB1477852-100,BYT-ORB1477852-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| This DT3C Protein spans the amino acid sequence from region 33-417aa(P00588)+linker(GGGGSGGGGSGGGGS)+291-497aa(P19909). Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 69.4 kDa |
| UniProt: | P19909 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Corynephage beta |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTAL |
| Application Notes: | Biological Origin: Corynephage beta. Biological Activity: After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CHOK1/Human CCR8 cells. The ED50 is 0.3708-0.5608 µg/ml. ②After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CT26/Human CCR8 cells. The ED50 is 0.4661-0.8614 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CHOK1/Human CCR8 cells. The ED50 is 0.3708-0.5608 µg/ml. |
|
|
After DT3C 10µg/ml formed complexes with different concentrations of Anti-CCR8 antibodies, cytotoxicity experiments were conducted on CT26/Human CCR8 cells. The ED50 is 0.4661-0.8614 µg/ml. |
Product Guarantee and Expert Support
