Human IL36A protein
Catalog Number:
BYT-ORB54522
- Images (3)
| Article Name: | Human IL36A protein |
| Biozol Catalog Number: | BYT-ORB54522 |
| Supplier Catalog Number: | orb54522 |
| Alternative Catalog Number: | BYT-ORB54522-20,BYT-ORB54522-100,BYT-ORB54522-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | FIL1 epsilon Interleukin-1 epsilon |
| This Human IL36A protein spans the amino acid sequence from region 1-158aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 44.7 kDa |
| UniProt: | Q9UHA7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-163AA: 1-158AAFull Length : Full Length |



