Bacterial lktA protein

Catalog Number: BYT-ORB54590
Article Name: Bacterial lktA protein
Biozol Catalog Number: BYT-ORB54590
Supplier Catalog Number: orb54590
Alternative Catalog Number: BYT-ORB54590-20,BYT-ORB54590-100,BYT-ORB54590-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: lktALeukotoxin, Lkt
This Bacterial lktA protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.2 kDa
UniProt: P55118
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mannheimia haemolytica (Pasteurella haemolytica)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT
Application Notes: Biological Origin: Mannheimia haemolytica (Pasteurella haemolytica). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged32-240AA: 1-229AAExtracellular Domain: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.