Human DSG3 protein
Catalog Number:
BYT-ORB604053
- Images (3)
| Article Name: | Human DSG3 protein |
| Biozol Catalog Number: | BYT-ORB604053 |
| Supplier Catalog Number: | orb604053 |
| Alternative Catalog Number: | BYT-ORB604053-1,BYT-ORB604053-100,BYT-ORB604053-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | 130 kDa pemphigus vulgaris antigen (PVA) (Cadherin family member 6) (CDHF6) |
| This Human DSG3 protein spans the amino acid sequence from region 50-615aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 67.0 kDa |
| UniProt: | P32926 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAV |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: Partial |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG3. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG3. |
Product Guarantee and Expert Support
