Bacteria Lachnospiraceae bacterium A4 Flagellin protein
Catalog Number:
BYT-ORB604469
- Images (3)
| Article Name: | Bacteria Lachnospiraceae bacterium A4 Flagellin protein |
| Biozol Catalog Number: | BYT-ORB604469 |
| Supplier Catalog Number: | orb604469 |
| Alternative Catalog Number: | BYT-ORB604469-1,BYT-ORB604469-100,BYT-ORB604469-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | / |
| This Bacteria Lachnospiraceae bacterium A4 Flagellin protein spans the amino acid sequence from region 1-520aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 56.2 kDa |
| UniProt: | A7IZG7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Lachnospiraceae bacterium A4 |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SGSTEKLSSGYRVNRAADDAAGLAISEKMRKQIRGLTQGSRNAEDGISCVQTAEGALAEVQDMLQRMNELAVQATNGTNSVTDRKYIQDEIDQLVTEIDRVSETTKFNETYLLKGDEELPENLVHTFNYAKGDKIDQLGTSSVLNAKSDRVMVNYNGVDNVYVVSASISSAGSKESMTADVKTKGSDFTKYLASGEVGTSSSVTSVAMSTSYAMFKNTNLNGVALQKMANGTVYADKDAYIYDTETKNIIHIKAT |
| Application Notes: | Biological Origin: Lachnospiraceae bacterium A4. Application Notes: Full Length |



